McDonnell Genome Institute

Washington University

Transcript

lnc-SORCS3-5:4

Chromosome

chr10

Gene Name

lnc-SORCS3-5

Start

106163347

CPC Label

noncoding

End

106188620

Cancer

EOGC

Strand

+

Peptide

SMLPSPVFRYTWLLSEK

Modified Peptide

n[145]SM[147]LPSPVFRYTWLLSEK

Peptide Length

17

ORF Length

37

Open Reading Frame (ORF)

LKIQAKSMLPSPVFRYTWLLSEKMETIFTQQHQLRFL

Conservation Score

1

PhyloCSF Frame 1

-5.648

No. of Spectra

1

CPC Coding Probability

0.0759907

PhyloCSF Frame 2 

-4.914

CNTI Index

noncoding

Max Probability

0.5725

PhyloCSF Frame 3

-2.971

CNTI Score

-0.42537346