McDonnell Genome Institute

Washington University

Transcript

lnc-SORCS1-9:2

Chromosome

chr10

Gene Name

lnc-SORCS1-9

Start

105798764

CPC Label

noncoding

End

105809187

Cancer

OV

Strand

-

Peptide

LIFIPMAAIR

Modified Peptide

n[145]LIFIPMAAIR

Peptide Length

10

ORF Length

33

Open Reading Frame (ORF)

LIFIPMAAIRKRQELCVLSFISFLCSSGKIEPI

Conservation Score

1

PhyloCSF Frame 1

-4.613

No. of Spectra

7

CPC Coding Probability

0.0372077

PhyloCSF Frame 2 

-3.288

CNTI Index

noncoding

Max Probability

0.9808

PhyloCSF Frame 3

-4.39

CNTI Score

-0.434954672