McDonnell Genome Institute

Washington University

Transcript

lnc-SORCS1-10:1

Chromosome

chr10

Gene Name

lnc-SORCS1-10

Start

105685382

CPC Label

noncoding

End

105685865

Cancer

EOGC

Strand

-

Peptide

EGMNIMEAR

Modified Peptide

n[145]EGMNIMEAR

Peptide Length

9

ORF Length

82

Open Reading Frame (ORF)

MAVVASPSMGRNLMMRILKHTGPGILSMTNVGPNTNSFQCFICTATTEWLDGKHIVFGKVKEGMNIMEAREHFGSRNGKTSK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.342613

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1758

PhyloCSF Frame 3

0

CNTI Score

-0.379871898