McDonnell Genome Institute

Washington University

Transcript

lnc-SORBS3-2:1

Chromosome

chr8

Gene Name

lnc-SORBS3-2

Start

22492630

CPC Label

noncoding

End

22493044

Cancer

CCRC

Strand

+

Peptide

MPANSFTITGHAETK

Modified Peptide

n[43]MPANSFTITGHAETK

Peptide Length

15

ORF Length

65

Open Reading Frame (ORF)

MPANSFTITGHAETKQLMEMLPSILNQLGAHCLTSLRRLAEALPKQSVNGKAPLATGEDDDEVPA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.224517

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9439

PhyloCSF Frame 3

0

CNTI Score

-0.350544382