McDonnell Genome Institute

Washington University

Transcript

lnc-SORBS3-1:6

Chromosome

chr8

Gene Name

lnc-SORBS3-1

Start

22545185

CPC Label

noncoding

End

22551165

Cancer

LUAD

Strand

+

Peptide

ASASPSWEK

Modified Peptide

n[230]ASASPSWEK

Peptide Length

9

ORF Length

39

Open Reading Frame (ORF)

MARIPGVGRASASPSWEKKEESESDVVLLSPKDPDSFHM

Conservation Score

1

PhyloCSF Frame 1

-0.067

No. of Spectra

3

CPC Coding Probability

0.0942091

PhyloCSF Frame 2 

3.847

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

-4.059

CNTI Score

-0.350794268