McDonnell Genome Institute

Washington University

Transcript

lnc-SOD3-10:1

Chromosome

chr4

Gene Name

lnc-SOD3-10

Start

24328763

CPC Label

noncoding

End

24333261

Cancer

OSCC

Strand

+

Peptide

ILNPMEVHFAHYGK

Modified Peptide

n[145]ILNPMEVHFAHYGK

Peptide Length

14

ORF Length

34

Open Reading Frame (ORF)

MRILNPMEVHFAHYGKHRNSSWYLEQSKSSINTC

Conservation Score

0.93

PhyloCSF Frame 1

-5.007

No. of Spectra

2

CPC Coding Probability

0.0424264

PhyloCSF Frame 2 

-4.319

CNTI Index

noncoding

Max Probability

0.9416

PhyloCSF Frame 3

-4.779

CNTI Score

-0.363337589