McDonnell Genome Institute

Washington University

Transcript

lnc-SOD1-9:4

Chromosome

chr21

Gene Name

lnc-SOD1-9

Start

31732270

CPC Label

noncoding

End

31748634

Cancer

PRAD

Strand

+

Peptide

CHHAPLIFVFLVETGFHHVDQGGLK

Modified Peptide

CHHAPLIFVFLVETGFHHVDQGGLK

Peptide Length

25

ORF Length

56

Open Reading Frame (ORF)

MCHHAPLIFVFLVETGFHHVDQGGLKLLTSSGLPTSAFQSVGITGVSHCVWLTHVY

Conservation Score

0.186

PhyloCSF Frame 1

0

No. of Spectra

7

CPC Coding Probability

0.359256

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9165

PhyloCSF Frame 3

0

CNTI Score

0.64378859