McDonnell Genome Institute

Washington University

Transcript

lnc-SOD1-2:1

Chromosome

chr21

Gene Name

lnc-SOD1-2

Start

31592722

CPC Label

noncoding

End

31593707

Cancer

HCC

Strand

+

Peptide

MEAVTEK

Modified Peptide

MEAVTEK

Peptide Length

7

ORF Length

38

Open Reading Frame (ORF)

MEAVTEKTLFLYMQPSRPYRTQPPDPGSINSALRISFC

Conservation Score

0.047

PhyloCSF Frame 1

-3.966

No. of Spectra

10

CPC Coding Probability

0.0688548

PhyloCSF Frame 2 

-5.936

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-5.568

CNTI Score

-0.382311903