McDonnell Genome Institute

Washington University

Transcript

lnc-SOCS6-8:1

Chromosome

chr18

Gene Name

lnc-SOCS6-8

Start

70464998

CPC Label

noncoding

End

70490708

Cancer

LUAD

Strand

+

Peptide

LNPTEEPR

Modified Peptide

n[230]LNPTEEPR

Peptide Length

8

ORF Length

68

Open Reading Frame (ORF)

LNPTEEPRMISLCLRGLPFSLCLRGLPPPPLNLGPEVCLLSLPSPFLVASEPKNLSWKPNGNSTQKPV

Conservation Score

0.163

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0335031

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9953

PhyloCSF Frame 3

-4.47

CNTI Score

-0.481422938