McDonnell Genome Institute

Washington University

Transcript

lnc-SOCS6-18:1

Chromosome

chr18

Gene Name

lnc-SOCS6-18

Start

72098934

CPC Label

noncoding

End

72108898

Cancer

CRC

Strand

+

Peptide

WLLCIQFK

Modified Peptide

WLLCIQFK

Peptide Length

8

ORF Length

51

Open Reading Frame (ORF)

LSFVSTFLLPSISSCKWLLCIQFKHFFSPRSHLFHLIQNIFFSAFFHSFPL

Conservation Score

0.006

PhyloCSF Frame 1

-3.514

No. of Spectra

1

CPC Coding Probability

0.00718845

PhyloCSF Frame 2 

-4.81

CNTI Index

noncoding

Max Probability

0.6821

PhyloCSF Frame 3

-5.4

CNTI Score

-0.340492083