McDonnell Genome Institute

Washington University

Transcript

lnc-SOCS5-1:1

Chromosome

chr2

Gene Name

lnc-SOCS5-1

Start

46777782

CPC Label

noncoding

End

46780245

Cancer

BRCA-Luminal B

Strand

+

Peptide

LASGLTAILWR

Modified Peptide

n[145]LASGLTAILWR

Peptide Length

11

ORF Length

47

Open Reading Frame (ORF)

LASGLTAILWRKYEFPISTKKVRLRGKGSCSRFALEQSQDSHSDLRL

Conservation Score

0.372

PhyloCSF Frame 1

-4.439

No. of Spectra

37

CPC Coding Probability

0.0517315

PhyloCSF Frame 2 

-5.032

CNTI Index

noncoding

Max Probability

0.9988

PhyloCSF Frame 3

-2.318

CNTI Score

-0.322320275