McDonnell Genome Institute

Washington University

Transcript

lnc-SOCS3-3:1

Chromosome

chr17

Gene Name

lnc-SOCS3-3

Start

78377288

CPC Label

noncoding

End

78379257

Cancer

PRAD

Strand

-

Peptide

APGGLHSCSHSSQVAEER

Modified Peptide

APGGLHSCSHSSQVAEER

Peptide Length

18

ORF Length

162

Open Reading Frame (ORF)

LAVPVPAEAVGQASQERGQPWAARQEAQQSPPEHGSRRSCRRHRHGDSPLPLPLPAGANFIDKGERGHGSGAQARNPWLGEGGAAPPPSLSFPSGGHRRGTVVAPQEGVGSRPVKSVRAPGGLHSCSHSSQVAEERMRRRGSSTVTLGSNSPAVKKAFVCLF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

11

CPC Coding Probability

0.159869

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7614

PhyloCSF Frame 3

11.92

CNTI Score

-0.258928608