McDonnell Genome Institute

Washington University

Transcript

lnc-SOBP-3:1

Chromosome

chr6

Gene Name

lnc-SOBP-3

Start

107459712

CPC Label

noncoding

End

107460376

Cancer

HCC

Strand

+

Peptide

CLLPAGAERK

Modified Peptide

n[230]CLLPAGAERK

Peptide Length

10

ORF Length

123

Open Reading Frame (ORF)

LELGPRLSGGTPSRGVGLSPRVLRAQPDIRQRGAAERGPKESPRIQLRITGLLAEPWEKQRCLLPAGAERKNETLPTPCLLSSSLCLAWSSTPGLKTIADRSAFHVLVHVLLYLILRTTSLSR

Conservation Score

0.017

PhyloCSF Frame 1

-3.169

No. of Spectra

1

CPC Coding Probability

0.052252

PhyloCSF Frame 2 

-4.131

CNTI Index

noncoding

Max Probability

0.7742

PhyloCSF Frame 3

-1.668

CNTI Score

-0.317728934