McDonnell Genome Institute

Washington University

Transcript

lnc-SOAT1-2:1

Chromosome

chr1

Gene Name

lnc-SOAT1-2

Start

179220937

CPC Label

noncoding

End

179222125

Cancer

EOGC

Strand

+

Peptide

IHSDVCQFGCVIAAHGFSSK

Modified Peptide

n[145]IHSDVCQFGCVIAAHGFSSK

Peptide Length

20

ORF Length

46

Open Reading Frame (ORF)

LNLLKVDIHIPEDTNLFFLYRIHSDVCQFGCVIAAHGFSSKEMITF

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0193805

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0556

PhyloCSF Frame 3

0

CNTI Score

-0.446548719