McDonnell Genome Institute

Washington University

Transcript

lnc-SNX20-8:5

Chromosome

chr16

Gene Name

lnc-SNX20-8

Start

50548507

CPC Label

coding

End

50613681

Cancer

HCC

Strand

-

Peptide

EPASDEFPRGAEAQDK

Modified Peptide

EPASDEFPRGAEAQDK

Peptide Length

16

ORF Length

91

Open Reading Frame (ORF)

MPCKENCTLNFRGFMNLPTTSPFVNFSLGTSESPDGETKGSKRDRTYPGSQSQRGAEPGSEYRGPTAGSKEPASDEFPRGAEAQDKSPHTP

Conservation Score

0.235

PhyloCSF Frame 1

-2.958

No. of Spectra

4

CPC Coding Probability

0.539266

PhyloCSF Frame 2 

-4.943

CNTI Index

noncoding

Max Probability

0.5718

PhyloCSF Frame 3

-4.332

CNTI Score

-0.236451629