McDonnell Genome Institute

Washington University

Transcript

lnc-SNX20-1:4

Chromosome

chr16

Gene Name

lnc-SNX20-1

Start

50727416

CPC Label

noncoding

End

50742815

Cancer

CCRC

Strand

-

Peptide

ISDGFKK

Modified Peptide

n[272]ISDGFKK

Peptide Length

7

ORF Length

84

Open Reading Frame (ORF)

MISDGFKKGSFPEQALFSCLLPCEMCLSPSAMIVRPPQPRGTTMKMMLDKKQIQAIFLFEFKMGCKAAETTHNISNAFGPGTAN

Conservation Score

0.096

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.0989634

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

-0.347085816