McDonnell Genome Institute

Washington University

Transcript

lnc-SNX20-1:3

Chromosome

chr16

Gene Name

lnc-SNX20-1

Start

50740909

CPC Label

noncoding

End

50742815

Cancer

EOGC

Strand

-

Peptide

LLFPNLCCHLSQFGGNFPK

Modified Peptide

n[145]LLFPNLCCHLSQFGGNFPK

Peptide Length

19

ORF Length

47

Open Reading Frame (ORF)

LGRLLFPNLCCHLSQFGGNFPKDGEEGISTRRLTQPRTPGHQPGLRV

Conservation Score

1

PhyloCSF Frame 1

-3.3

No. of Spectra

6

CPC Coding Probability

0.00600784

PhyloCSF Frame 2 

-4.789

CNTI Index

noncoding

Max Probability

0.981

PhyloCSF Frame 3

-4.303

CNTI Score

-0.391695182