McDonnell Genome Institute

Washington University

Transcript

lnc-SNX2-1:1

Chromosome

chr5

Gene Name

lnc-SNX2-1

Start

122832355

CPC Label

noncoding

End

122834533

Cancer

EOGC

Strand

+

Peptide

KVDNGSDMEIAIK

Modified Peptide

n[145]KVDNGSDMEIAIK

Peptide Length

13

ORF Length

40

Open Reading Frame (ORF)

MKVDNGSDMEIAIKGNYNKINVSNSSFSCIFDEGHEDRSW

Conservation Score

0.019

PhyloCSF Frame 1

-6.109

No. of Spectra

40

CPC Coding Probability

0.0445544

PhyloCSF Frame 2 

-4.739

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-6.224

CNTI Score

-0.459918946