McDonnell Genome Institute

Washington University

Transcript

lnc-SNX19-4:1

Chromosome

chr11

Gene Name

lnc-SNX19-4

Start

130780575

CPC Label

noncoding

End

130784358

Cancer

CCRC

Strand

-

Peptide

TWWDLHYGAK

Modified Peptide

n[230]TWWDLHYGAK

Peptide Length

10

ORF Length

51

Open Reading Frame (ORF)

LLMVHSLHSSVCAGKTWWDLHYGAKADTSASECFQKSNFCSSLSQPCGGVT

Conservation Score

0.008

PhyloCSF Frame 1

-4.112

No. of Spectra

11

CPC Coding Probability

0.0299382

PhyloCSF Frame 2 

-4.787

CNTI Index

noncoding

Max Probability

0.9974

PhyloCSF Frame 3

-4.296

CNTI Score

-0.395554077