McDonnell Genome Institute

Washington University

Transcript

lnc-SNX13-2:6

Chromosome

chr7

Gene Name

lnc-SNX13-2

Start

17433077

CPC Label

noncoding

End

17434684

Cancer

HCC

Strand

-

Peptide

ELTMSIIELEFK

Modified Peptide

n[230]ELTM[147]SIIELEFK

Peptide Length

12

ORF Length

45

Open Reading Frame (ORF)

LLGELKTFQEIENIGVLESLLKSVKELTMSIIELEFKYQMLSQNS

Conservation Score

0.82

PhyloCSF Frame 1

-6.437

No. of Spectra

3

CPC Coding Probability

0.158649

PhyloCSF Frame 2 

-5.388

CNTI Index

noncoding

Max Probability

0.9994

PhyloCSF Frame 3

-3.76

CNTI Score

-0.362552268