McDonnell Genome Institute

Washington University

Transcript

lnc-SNX12-1:1

Chromosome

chrX

Gene Name

lnc-SNX12-1

Start

71043213

CPC Label

noncoding

End

71045470

Cancer

OV

Strand

-

Peptide

VMDRYESEALLEGK

Modified Peptide

n[145]VMDRYESEALLEGK

Peptide Length

14

ORF Length

56

Open Reading Frame (ORF)

LLQTTGNPCYWRVMDRYESEALLEGKCEDTFLLRDAGQRDCLFSMNFWGYNRSLQA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.120391

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4708

PhyloCSF Frame 3

0

CNTI Score

-0.385900798