McDonnell Genome Institute

Washington University

Transcript

lnc-SNX10-4:1

Chromosome

chr7

Gene Name

lnc-SNX10-4

Start

26276194

CPC Label

noncoding

End

26276606

Cancer

HCC

Strand

+

Peptide

DEMKGSAITGPVAK

Modified Peptide

n[230]DEMKGSAITGPVAK

Peptide Length

14

ORF Length

56

Open Reading Frame (ORF)

LTTKVIWRKDGVFLYFEGNAGVIIKNKDEMKGSAITGPVAKECADLWPRIAFNTGS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0641255

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8824

PhyloCSF Frame 3

0

CNTI Score

-0.398714469