McDonnell Genome Institute

Washington University

Transcript

lnc-SNX10-2:9

Chromosome

chr7

Gene Name

lnc-SNX10-2

Start

26403395

CPC Label

noncoding

End

26496362

Cancer

OV

Strand

+

Peptide

GLAALQGR

Modified Peptide

n[145]GLAALQGR

Peptide Length

8

ORF Length

86

Open Reading Frame (ORF)

LKAGFPWKPAAHPPAPLPCLLQPPLKHCRGLAALQGRVKTDTSTHIPISSHLRRLNAFFPCFTLLGFSSPCFFFLYISYKKKKRSY

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0968707

PhyloCSF Frame 2 

-2.489

CNTI Index

noncoding

Max Probability

0.4848

PhyloCSF Frame 3

0

CNTI Score

-0.332936517