McDonnell Genome Institute

Washington University

Transcript

lnc-SNX10-2:5

Chromosome

chr7

Gene Name

lnc-SNX10-2

Start

26398651

CPC Label

noncoding

End

26399654

Cancer

OV

Strand

+

Peptide

NIDCILK

Modified Peptide

n[145]NIDCILK

Peptide Length

7

ORF Length

59

Open Reading Frame (ORF)

LLTGAATDHKRLPRACSVARPDQDVLQVGNTHPIVKKTVWKKECELAHSSFKNIDCILK

Conservation Score

0.985

PhyloCSF Frame 1

-2.314

No. of Spectra

29

CPC Coding Probability

0.0141821

PhyloCSF Frame 2 

-1.66

CNTI Index

noncoding

Max Probability

0.9703

PhyloCSF Frame 3

-1.807

CNTI Score

-0.344133864