McDonnell Genome Institute

Washington University

Transcript

lnc-SNW1-6:1

Chromosome

chr14

Gene Name

lnc-SNW1-6

Start

77683201

CPC Label

noncoding

End

77683989

Cancer

OV

Strand

-

Peptide

DDIVDVVDIK

Modified Peptide

n[145]DDIVDVVDIK

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

LAMYMRICKRDDIVDVVDIKGMGMGTVQKGMAHKCCHGKTGRVYSVPQHAVSIVVNK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0866406

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9068

PhyloCSF Frame 3

0

CNTI Score

-0.338311753