McDonnell Genome Institute

Washington University

Transcript

lnc-SNU13-3:1

Chromosome

chr22

Gene Name

lnc-SNU13-3

Start

41793831

CPC Label

noncoding

End

41800519

Cancer

CRC

Strand

-

Peptide

KLNLWVGSVPNLRR

Modified Peptide

‚Äč

Peptide Length

14

ORF Length

81

Open Reading Frame (ORF)

LWAPSSSCPSCGPWVRGPGFSLCWRKLNLWVGSVPNLRRESANWGPSSCRPGDLLRALPETVSSSVAEFLNFRSQREFSGR

Conservation Score

0.074

PhyloCSF Frame 1

-4.272

No. of Spectra

2

CPC Coding Probability

0.299989

PhyloCSF Frame 2 

1.207

CNTI Index

noncoding

Max Probability

0.9035

PhyloCSF Frame 3

-0.949

CNTI Score

-0.292368149