McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPN-8:148

Chromosome

chr15

Gene Name

lnc-SNRPN-8

Start

25172978

CPC Label

noncoding

End

25182051

Cancer

BRCA-Luminal A

Strand

+

Peptide

VTVEEDLLWDR

Modified Peptide

n[145]VTVEEDLLWDR

Peptide Length

11

ORF Length

41

Open Reading Frame (ORF)

MVTVEEDLLWDRWPQASGCHPGAQPLVHLSSSPSWCPGLLP

Conservation Score

0.006

PhyloCSF Frame 1

-5.095

No. of Spectra

26

CPC Coding Probability

0.0465425

PhyloCSF Frame 2 

-4.797

CNTI Index

noncoding

Max Probability

0.999

PhyloCSF Frame 3

-4.237

CNTI Score

-0.31404759