McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPN-8:115

Chromosome

chr15

Gene Name

lnc-SNRPN-8

Start

25053866

CPC Label

noncoding

End

25115657

Cancer

OV

Strand

+

Peptide

GLPLAGK

Modified Peptide

n[145]GLPLAGK

Peptide Length

7

ORF Length

109

Open Reading Frame (ORF)

LPWEVRCLLSRKMVDASEKQALRVPGFGVAWHPRCTPCWRVAQDGAVALRGPPPAGMTDGQFFRAVESPWSRGVGVASHPQCTLCWWMAQDTVVMRGLPLAGKEDGQFF

Conservation Score

0.132

PhyloCSF Frame 1

-4.589

No. of Spectra

1

CPC Coding Probability

0.177935

PhyloCSF Frame 2 

-4.401

CNTI Index

noncoding

Max Probability

0.9883

PhyloCSF Frame 3

-5.519

CNTI Score

-0.343873386