McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPN-8:112

Chromosome

chr15

Gene Name

lnc-SNRPN-8

Start

25050631

CPC Label

noncoding

End

25122476

Cancer

OV

Strand

+

Peptide

VPGFGVAWHPR

Modified Peptide

n[145]VPGFGVAWHPR

Peptide Length

11

ORF Length

112

Open Reading Frame (ORF)

LPWEVRCLLSRKMVDASEKQALRVPGFGVAWHPRCTPCWRVAQDGAVALRGPPPAGMTDGQFFRAVESPWSRGVGVASHPQCTLCWWMAQDRAVAVGGLPSAERKMVDASEQ

Conservation Score

0.132

PhyloCSF Frame 1

-4.589

No. of Spectra

1

CPC Coding Probability

0.312078

PhyloCSF Frame 2 

-4.549

CNTI Index

noncoding

Max Probability

0.879

PhyloCSF Frame 3

-3.224

CNTI Score

-0.339473824