McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPN-8:105

Chromosome

chr15

Gene Name

lnc-SNRPN-8

Start

25015939

CPC Label

noncoding

End

25036491

Cancer

BRCA-Luminal B

Strand

+

Peptide

VVENICK

Modified Peptide

n[145]VVENICK

Peptide Length

7

ORF Length

48

Open Reading Frame (ORF)

LPFFTYQINRLYVLTRWGEFTTPDMLKSFRKVVENICKMEISTFDQQF

Conservation Score

0.937

PhyloCSF Frame 1

-5.476

No. of Spectra

5

CPC Coding Probability

0.113053

PhyloCSF Frame 2 

-5.223

CNTI Index

noncoding

Max Probability

0.9976

PhyloCSF Frame 3

-5.198

CNTI Score

-0.372668427