McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPN-8:101

Chromosome

chr15

Gene Name

lnc-SNRPN-8

Start

25000313

CPC Label

noncoding

End

25002404

Cancer

LUAD

Strand

+

Peptide

HVNILSR

Modified Peptide

n[230]HVNILSR

Peptide Length

7

ORF Length

41

Open Reading Frame (ORF)

LKSSFMIKHVNILSRIANMFFLIHFTMVFYFLVIQKLYIEI

Conservation Score

0.998

PhyloCSF Frame 1

-3.498

No. of Spectra

1

CPC Coding Probability

0.0276061

PhyloCSF Frame 2 

-5.406

CNTI Index

noncoding

Max Probability

0.9954

PhyloCSF Frame 3

-5.929

CNTI Score

-0.49727878