McDonnell Genome Institute

Washington University

Transcript

lnc-SNRPE-3:1

Chromosome

chr1

Gene Name

lnc-SNRPE-3

Start

203954639

CPC Label

noncoding

End

203955780

Cancer

BRCA-Luminal A

Strand

+

Peptide

NSDEADLFPGK

Modified Peptide

n[145]NSDEADLFPGK

Peptide Length

11

ORF Length

66

Open Reading Frame (ORF)

LAPEQIIGATYSSGELMIPMTWKNSDEADLFPGKEASIKCPQVVISFYEERHSYPKKEDEKKDDKN

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.246186

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5052

PhyloCSF Frame 3

0

CNTI Score

-0.317472085