McDonnell Genome Institute

Washington University

Transcript

lnc-SNRK-2:1

Chromosome

chr3

Gene Name

lnc-SNRK-2

Start

43190293

CPC Label

noncoding

End

43190625

Cancer

EOGC

Strand

+

Peptide

LGDLPISSPTPSYH

Modified Peptide

n[145]LGDLPISSPTPSYH

Peptide Length

14

ORF Length

46

Open Reading Frame (ORF)

MLLLCSNPPMLPYHDQRKVKSFYHPSRPYTVRLGDLPISSPTPSYH

Conservation Score

0.064

PhyloCSF Frame 1

-4.794

No. of Spectra

1

CPC Coding Probability

0.0496166

PhyloCSF Frame 2 

-4.032

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-3.524

CNTI Score

-0.477430236