McDonnell Genome Institute

Washington University

Transcript

lnc-SNN-6:1

Chromosome

chr16

Gene Name

lnc-SNN-6

Start

11797519

CPC Label

noncoding

End

11798879

Cancer

CRC

Strand

+

Peptide

TILVGEDQR

Modified Peptide

Peptide Length

9

ORF Length

78

Open Reading Frame (ORF)

LEGLDPCPSGPSPNAASSICILRPGAPLRARLLVKCSAQQWARQGPCPMGWRAEIRTHKSPKKTILVGEDQRNSSRRM

Conservation Score

0.042

PhyloCSF Frame 1

-3.04

No. of Spectra

1

CPC Coding Probability

0.094696

PhyloCSF Frame 2 

-3.884

CNTI Index

noncoding

Max Probability

0.7236

PhyloCSF Frame 3

-4.249

CNTI Score

-0.318126939