McDonnell Genome Institute

Washington University

Transcript

lnc-SNF8-1:2

Chromosome

chr17

Gene Name

lnc-SNF8-1

Start

48874913

CPC Label

noncoding

End

48875198

Cancer

LUAD

Strand

-

Peptide

VAGQDGSMVQFK

Modified Peptide

n[230]VAGQDGSMVQFK

Peptide Length

12

ORF Length

37

Open Reading Frame (ORF)

LKVAGQDGSMVQFKIKRHTPLSKLMKAYCEQQGLSMR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

18

CPC Coding Probability

0.0218823

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9775

PhyloCSF Frame 3

0

CNTI Score

-0.368275052