McDonnell Genome Institute

Washington University

Transcript

lnc-SNCB-1:1

Chromosome

chr5

Gene Name

lnc-SNCB-1

Start

176707355

CPC Label

noncoding

End

176726243

Cancer

OV

Strand

-

Peptide

FTESSLQMLR

Modified Peptide

n[145]FTESSLQM[147]LR

Peptide Length

10

ORF Length

94

Open Reading Frame (ORF)

MWGKSKFTESSLQMLRGWCLRQGRWMTRNYPPGSPSLTPLPPAWSPSNFRLFVHPEQRLCTISLAGRSGFQGLLTAGWAPGLLGPSLSSLRRAF

Conservation Score

1

PhyloCSF Frame 1

-3.839

No. of Spectra

37

CPC Coding Probability

0.450168

PhyloCSF Frame 2 

-2.303

CNTI Index

noncoding

Max Probability

0.994

PhyloCSF Frame 3

-0.774

CNTI Score

-0.375043718