McDonnell Genome Institute

Washington University

Transcript

lnc-SNCA-2:1

Chromosome

chr4

Gene Name

lnc-SNCA-2

Start

89538215

CPC Label

coding

End

89551556

Cancer

CRC

Strand

-

Peptide

MPAVHTPQSFLFR

Modified Peptide

‚Äč

Peptide Length

13

ORF Length

73

Open Reading Frame (ORF)

MMPAVHTPQSFLFREIAEMSCLPMRGRQKSECQLKIPEQYCHSKSQAYCSIAKVLVQSKDNFSQVIEWSSKCL

Conservation Score

0.263

PhyloCSF Frame 1

-3.883

No. of Spectra

1

CPC Coding Probability

0.509007

PhyloCSF Frame 2 

-4.461

CNTI Index

noncoding

Max Probability

0.7859

PhyloCSF Frame 3

-5.886

CNTI Score

-0.387441489