McDonnell Genome Institute

Washington University

Transcript

lnc-SNAPC3-11:1

Chromosome

chr9

Gene Name

lnc-SNAPC3-11

Start

14314231

CPC Label

noncoding

End

14359244

Cancer

OSCC

Strand

+

Peptide

ASQTMEGGK

Modified Peptide

n[145]ASQTM[147]EGGK

Peptide Length

9

ORF Length

148

Open Reading Frame (ORF)

LQPRWLAPNPHPPGPGAPAESVSLPARVQAGRGRGAPGAAGRAGGRARAAAALQRLRALSRSAPAPAPHRGAAPPPPRRPCRLRVNELDSRDFEEGGSPCTLSAPPAHIHTPPPKSSFLLGVDGDEGEAKASQTMEGGKVSAWGSEST

Conservation Score

1

PhyloCSF Frame 1

0.823

No. of Spectra

3

CPC Coding Probability

0.161211

PhyloCSF Frame 2 

3.159

CNTI Index

coding

Max Probability

0.5442

PhyloCSF Frame 3

0.727

CNTI Score

0.694655637