McDonnell Genome Institute

Washington University

Transcript

lnc-SNAPC2-2:3

Chromosome

chr19

Gene Name

lnc-SNAPC2-2

Start

7926222

CPC Label

noncoding

End

7926810

Cancer

OV

Strand

+

Peptide

SQAYAQDGR

Modified Peptide

n[145]SQAYAQDGR

Peptide Length

9

ORF Length

90

Open Reading Frame (ORF)

LSVTGLVFQLRVQPWARRPPTAAAVPHSTLTASHSSRLLPPPPSPRPLPRQRRHFRLRSCSSAIRCFILSKSQAYAQDGRALLKLKNGPK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0136266

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9104

PhyloCSF Frame 3

0

CNTI Score

-0.359458595