McDonnell Genome Institute

Washington University

Transcript

lnc-SNAP25-4:1

Chromosome

chr20

Gene Name

lnc-SNAP25-4

Start

10309629

CPC Label

noncoding

End

10312102

Cancer

BRCA-Luminal A

Strand

+

Peptide

LGTERLTIYK

Modified Peptide

n[145]LGTERLTIYK

Peptide Length

10

ORF Length

78

Open Reading Frame (ORF)

LSFHYISSPVLSIGKTALGETKSKQTKQGKFLALTELTLKLGTERLTIYKGYGMVNVVEKCNTMKGVQSIRGRTEGVS

Conservation Score

0.417

PhyloCSF Frame 1

-3.848

No. of Spectra

1

CPC Coding Probability

0.0697269

PhyloCSF Frame 2 

-4.945

CNTI Index

noncoding

Max Probability

0.7526

PhyloCSF Frame 3

-4.83

CNTI Score

-0.413806513