McDonnell Genome Institute

Washington University

Transcript

lnc-SNAP25-1:8

Chromosome

chr20

Gene Name

lnc-SNAP25-1

Start

10172428

CPC Label

noncoding

End

10215516

Cancer

LUAD

Strand

+

Peptide

RWFVGYAAK

Modified Peptide

RWFVGYAAK

Peptide Length

9

ORF Length

52

Open Reading Frame (ORF)

LATLDKSEKERCQPFSPGDDDGDGQCPLPNIYIGKRWFVGYAAKRIFFFKNK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

8

CPC Coding Probability

0.188715

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9995

PhyloCSF Frame 3

0

CNTI Score

-0.351992865