McDonnell Genome Institute

Washington University

Transcript

lnc-SNAP25-1:6

Chromosome

chr20

Gene Name

lnc-SNAP25-1

Start

10172428

CPC Label

noncoding

End

10207245

Cancer

OV

Strand

+

Peptide

KVPLSVTK

Modified Peptide

n[145]KVPLSVTK

Peptide Length

8

ORF Length

36

Open Reading Frame (ORF)

LRQLNMQLNMKHRWQKNKKVPLSVTKKLVGRSGPRL

Conservation Score

0.075

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.45625

PhyloCSF Frame 2 

-5.935

CNTI Index

noncoding

Max Probability

0.3134

PhyloCSF Frame 3

0

CNTI Score

-0.362335248