McDonnell Genome Institute

Washington University

Transcript

lnc-SNAP25-1:5

Chromosome

chr20

Gene Name

lnc-SNAP25-1

Start

10172428

CPC Label

noncoding

End

10201065

Cancer

EOGC

Strand

+

Peptide

GHMTWLK

Modified Peptide

n[145]GHMTWLK

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LFIKPWLSFSRGVGGLTSPLPKVKKGHMTWLKHE

Conservation Score

0.813

PhyloCSF Frame 1

-6.635

No. of Spectra

2

CPC Coding Probability

0.076875

PhyloCSF Frame 2 

-4.287

CNTI Index

noncoding

Max Probability

0.0778

PhyloCSF Frame 3

-4.497

CNTI Score

-0.350847187