McDonnell Genome Institute

Washington University

Transcript

lnc-SNAI2-7:1

Chromosome

chr8

Gene Name

lnc-SNAI2-7

Start

49817585

CPC Label

noncoding

End

49820944

Cancer

OV

Strand

-

Peptide

LQGWCLTMLPR

Modified Peptide

n[145]LQGWCLTM[147]LPR

Peptide Length

11

ORF Length

50

Open Reading Frame (ORF)

LQGWCLTMLPRLFSNPGLKQISHLLLPKCWDYKCEPLYPAYLGGHLLFTY

Conservation Score

0.031

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0153072

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7896

PhyloCSF Frame 3

0

CNTI Score

-0.415916099