McDonnell Genome Institute

Washington University

Transcript

lnc-SNAI1-3:1

Chromosome

chr20

Gene Name

lnc-SNAI1-3

Start

50078877

CPC Label

noncoding

End

50093698

Cancer

BRCA-Luminal B

Strand

+

Peptide

VTQQIAHVLIMK

Modified Peptide

n[145]VTQQIAHVLIMK

Peptide Length

12

ORF Length

40

Open Reading Frame (ORF)

MSYSSALFRCFNNYVDIRVTQQIAHVLIMKDWSQEASTHR

Conservation Score

0.269

PhyloCSF Frame 1

-4.735

No. of Spectra

33

CPC Coding Probability

0.0115794

PhyloCSF Frame 2 

-4.474

CNTI Index

noncoding

Max Probability

0.9969

PhyloCSF Frame 3

-5.087

CNTI Score

-0.429211667