McDonnell Genome Institute

Washington University

Transcript

lnc-SMURF2-2:1

Chromosome

chr17

Gene Name

lnc-SMURF2-2

Start

64747263

CPC Label

noncoding

End

64747492

Cancer

PRAD

Strand

-

Peptide

MLELELSR

Modified Peptide

M[147]LELELSR

Peptide Length

8

ORF Length

34

Open Reading Frame (ORF)

MLELELSRKWDQCLADAVVKTGTGFGLGIVFSLL

Conservation Score

1

PhyloCSF Frame 1

-3.461

No. of Spectra

1

CPC Coding Probability

0.021782

PhyloCSF Frame 2 

-3.922

CNTI Index

noncoding

Max Probability

0.5883

PhyloCSF Frame 3

-3.718

CNTI Score

-0.42306438