McDonnell Genome Institute

Washington University

Transcript

lnc-SMU1-1:1

Chromosome

chr9

Gene Name

lnc-SMU1-1

Start

32979559

CPC Label

coding

End

32980403

Cancer

OV

Strand

-

Peptide

NTAGALDLPK

Modified Peptide

n[145]NTAGALDLPK

Peptide Length

10

ORF Length

53

Open Reading Frame (ORF)

MDKMVQKNTAGALDLPKELKNIPMTMELLQPPEESEYQLMLMASSIKMKKLHL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.894999

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7152

PhyloCSF Frame 3

0

CNTI Score

-0.336785827