McDonnell Genome Institute

Washington University

Transcript

lnc-SMTNL2-3:1

Chromosome

chr17

Gene Name

lnc-SMTNL2-3

Start

4572205

CPC Label

noncoding

End

4572515

Cancer

OV

Strand

+

Peptide

LVIVDFSATWCGPCK

Modified Peptide

n[145]LVIVDFSATWCGPCK

Peptide Length

15

ORF Length

42

Open Reading Frame (ORF)

LDATGDKLVIVDFSATWCGPCKMIKPFFIPSLESIPAWYSLK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.152615

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

1

PhyloCSF Frame 3

0

CNTI Score

-0.360755513