McDonnell Genome Institute

Washington University

Transcript

lnc-SMPD3-3:1

Chromosome

chr16

Gene Name

lnc-SMPD3-3

Start

68477236

CPC Label

noncoding

End

68477570

Cancer

HCC

Strand

-

Peptide

NNTVTPGCK

Modified Peptide

n[230]NNTVTPGCK

Peptide Length

9

ORF Length

63

Open Reading Frame (ORF)

LGKRCTYVYKAKNNTVTPGCKQNKTRAIWGKVTQAHGNSGMFRAKFQRNLPAKAGSLSWGHRI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0182069

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.434046716