McDonnell Genome Institute

Washington University

Transcript

lnc-SMOC2-8:3

Chromosome

chr6

Gene Name

lnc-SMOC2-8

Start

169158341

CPC Label

noncoding

End

169184361

Cancer

OV

Strand

+

Peptide

GERHFLCGGGK

Modified Peptide

n[145]GERHFLCGGGK

Peptide Length

11

ORF Length

46

Open Reading Frame (ORF)

MLLIKIYPRLGRKRGLIGLTVPHGWGGHRIMMRGERHFLCGGGKRK

Conservation Score

0.041

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.422637

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.4531

PhyloCSF Frame 3

0

CNTI Score

-0.292213794